PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK22670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Whirly
Protein Properties Length: 289aa    MW: 32051.1 Da    PI: 9.7375
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK22670.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly216.91.9e-671122501139
     Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100
                s+yk+kaal+v++++p+f+aldsg++k++++G++ll++a+a+++r ydW++kq+f+ls+te+++lv+l++ +sceffhdp+++ s+eG+vrk lkvePlp
  PK22670.1 112 SIYKGKAALTVEPKAPEFTALDSGAFKVSKEGFVLLQFAPAAGVRVYDWSRKQVFSLSVTEIGNLVSLGATGSCEFFHDPFKGRSDEGQVRKMLKVEPLP 211
                7*************************************************************************************************** PP

     Whirly 101 dGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                dGsG+f+nlsv+n+l++ +e++++Pv++aefavl+s+++
  PK22670.1 212 DGSGHFFNLSVQNKLINLDENIYIPVTRAEFAVLNSAFN 250
                ***********************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.1E-77100272IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-78106289IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.1E-60113247IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
XEGRGVKFWM MMMRPYSLSS SSSLTVTPQN PKLSAAHSFF FPPLSGTTAL TFSSNPTHLT  60
KRLSLKCRQS EYFDQQKLAT TTAHYDNSSS FAPQTPSSRA DQVPARFYVG HSIYKGKAAL  120
TVEPKAPEFT ALDSGAFKVS KEGFVLLQFA PAAGVRVYDW SRKQVFSLSV TEIGNLVSLG  180
ATGSCEFFHD PFKGRSDEGQ VRKMLKVEPL PDGSGHFFNL SVQNKLINLD ENIYIPVTRA  240
EFAVLNSAFN FILPHLLGWS AFANSIKPEE MSRGNNASPK YGGDYEWKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-10410628737218p24: plant transcriptional regulator PBF-2
1l3a_B1e-10410628737218p24: plant transcriptional regulator PBF-2
1l3a_C1e-10410628737218p24: plant transcriptional regulator PBF-2
1l3a_D1e-10410628737218p24: plant transcriptional regulator PBF-2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297331.11e-135PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-125WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLD9ZJE71e-133D9ZJE7_MALDO; WHY domain class transcription factor
STRINGAT1G14410.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-126ssDNA-binding transcriptional regulator